Brand | ProteoGenix |
Product type | Proteins |
Origin species | Human |
Host species | Mammalian |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P4060-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Human TNFSF9/4-1BBL recombinant protein |
Fragment type: | Partial |
Origin species: | Human |
Expression system: | Eukaryotic expression |
Host species: | Mammalian |
Molecular weight with tag if any: | 22.64kDa |
Purity estimated: | 50% |
Uniprot id: | P41273 |
Uniprot link: | http://www.uniprot.org/uniprot/P41273 |
Aliases / synonyms: | 4 1BB L, 4 1BB ligand, 4 1BBL, 4-1BB ligand, 4-1BBL, Cd137l, Cd157l, Homolog of mouse 4 1BB L, Homolog of mouse 4 1BBL, ILA ligand (TNF related), Ly63l, Receptor 4 1BB ligand, TNF superfamily member 9, TNFL9_HUMAN, Tnfsf9, TNLG5A, Tumor necrosis factor (ligand) superfamily member 9, Tumor necrosis factor ligand 5A, Tumor necrosis factor ligand superfamily member 9, Tumor necrosis factor superfamily member 9 |
Protein sequence (w/o tag): | MGSHHHHHHSGACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
Form: | Lyophilized |
Buffer: | PBS, pH 7.5 |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | any condition |
Delivery lead time in business days: | 5-7 |
Related products: | - Human PAFAH/ LpPLA2/PLA2G7 recombinant protein - Sparus aurata Interleukin 10 (IL10) recombinant protein - Rhesus monkey IL37/Interleukin 1 Zeta (IL1z) recombinant protein |
Image: | ![]() |