New product
Availability date:
Brand | ProteoGenix |
Product type | Proteins |
Origin species | Human |
Host species | Escherichia coli (E. coli) |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P4050-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Human Galectin3 (GAL3) recombinant protein |
Fragment type: | Full-length |
Origin species: | Human |
Expression system: | Prokaryotic expression |
Host species: | Escherichia coli (E. coli) |
Molecular weight with tag if any: | 27.17kDa |
Purity estimated: | 80% |
Uniprot id: | P17931 |
Uniprot link: | http://www.uniprot.org/uniprot/P17931 |
Aliases / synonyms: | LGALS3, CBP35, GALBP, GALIG, MAC2, 35 kDa lectin, Carbohydrate-binding protein 35, Galactose-specific lectin 3, Galactoside-binding protein, Laminin-binding protein, Lectin L-29 |
Protein sequence (w/o tag): | MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMILEHHHHHH |
Form: | Lyophilized |
Buffer: | 50 mM Tris-HCl pH 8, 150 mM NaCl |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | any condition |
Delivery lead time in business days: | 5-7 |
Related products: | - Human Golgi membrane protein 1 (GP73) recombinant protein - Human SIRT1 recombinant protein - Human CKMB recombinant protein |
Image: | ![]() |