Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human BNP peptide/Natriuretic peptides B
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Escherichia coli (E. coli) |
More info about Human BNP peptide/Natriuretic peptides B
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P4047-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human BNP peptide/Natriuretic peptides B |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 28.85kDa |
| Purity estimated: | 85% |
| Uniprot id: | P16860 |
| Uniprot link: | http://www.uniprot.org/uniprot/P16860 |
| Aliases / synonyms: | NT-PROBNP, BNP, Natriuretic peptide B, GC-B, B-Type Natriuretic Peptide, Ventricular Natriuretic Peptide, Gamma-brain natriuretic peptide, Brain natriuretic peptide 32 |
| Protein sequence (w/o tag): | MGSHHHHHHSGHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR |
| Form: | Lyophilized |
| Buffer: | 50 mM Tris-HCl pH 8, 150 mM NaCl |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | any condition |
| Delivery lead time in business days: | 5-7 |
| Related products: | - Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein - Human Galectin-1 (GAL1) recombinant protein - Human Galectin3 (GAL3) recombinant protein |
| Image: |  |