View larger

Human BNP peptide/Natriuretic peptides B

PX-P4047-10

New product

135,00 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human BNP peptide/Natriuretic peptides B

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human BNP peptide/Natriuretic peptides B

Brand: ProteoGenix
Proteogenix reference: PX-P4047-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human BNP peptide/Natriuretic peptides B
Fragment type: Partial
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 28.85kDa
Purity estimated: 85%
Uniprot id: P16860
Uniprot link: http://www.uniprot.org/uniprot/P16860
Aliases / synonyms: NT-PROBNP, BNP, Natriuretic peptide B, GC-B, B-Type Natriuretic Peptide, Ventricular Natriuretic Peptide, Gamma-brain natriuretic peptide, Brain natriuretic peptide 32
Protein sequence (w/o tag): MGSHHHHHHSGHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPR
Form: Lyophilized
Buffer: 50 mM Tris-HCl pH 8, 150 mM NaCl
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: any condition
Delivery lead time in business days: 5-7
Related products: - Human Troponin C, slow skeletal and cardiac muscles (TNNC1) recombinant protein
- Human Galectin-1 (GAL1) recombinant protein
- Human Galectin3 (GAL3) recombinant protein
Image: PX-P4047.jpg

Reviews

Buy Human BNP peptide/Natriuretic peptides B now

Add to cart