Cart (0 Items)
Your cart is currently empty.
View Productssize | 100ug, 50ug |
---|---|
Brand | ProteoGenix |
Product type | Recombinant Proteins |
Host Species | Mammalian cells |
Applications | Elisa, WB |
Product name | Human Tumor necrosis factor receptor superfamily member 1A (TNFR1A) recombinant protein |
---|---|
Uniprot ID | P19438 |
Uniprot link | http://www.uniprot.org/uniprot/P19438 |
Origin species | Homo sapiens (Human) |
Expression system | Eukaryotic expression |
Sequence | MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTTGSHHHHHH |
Molecular weight | 24.35kDa |
Purity estimated | 90% |
Buffer | 50 mM Tris-HCl pH 8, 150 mM NaCl |
Form | Lyophilized |
Delivery condition | Dry Ice |
Delivery lead time in business days | 5-7 |
Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Brand | ProteoGenix |
Host species | Mammalian cells |
Applications | ELISA,WB |
Fragment Type | Partial |
Aliases /Synonyms | CD120A, P55, TBP1, FPF, TNF-R, TNF-R-I, TNF-R55, TNFAR, TNFR1, TNFR55, TNFR60, P55-R, P60, Tumor necrosis factor receptor 1, Tumor necrosis factor-binding protein 1 |
Reference | PX-P4037 |
Note | For research use only |
Related products
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Your cart is currently empty.
View Products
Reviews
There are no reviews yet.