Cart (0 Items)
Your cart is currently empty.
View ProductsElizabethkingia miricola PNGaseF Recombinant Protein
Active
| size | 15000u, 75000u, 50ug, 100ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Elizabethkingia miricola PNGaseF Recombinant Protein |
|---|---|
| Uniprot ID | P21163 |
| Uniprot link | http://www.uniprot.org/uniprot/P21163 |
| Origin species | Schizosaccharomyces pombe |
| Expression system | Prokaryotic expression |
| Sequence | MAHNHRHKHKLSVHSDNQSQISIEVGRDAPAAAATDLSGIIGPQMTKSPASSVTHFSTPSMLPIGGTSLDDELLAPVDDL NLDLGLDDLLGDEQGANAPAIEADEQAETSSIHLPSDIMEDDSSRPAAAGVEEGQVVESATAPQQEKINPQKTVRRQRAI IDPVTELSSKQMKKQLADTSSITSPLCLNTSSIVFNATVNFTRNGKFNTSIFSSNLNPKVNELLQADFKQAILRKRKNES PEEVEPAKHQRTDTSTENQETAEVLDPEEIAAAELANITEAAIATLPQETVVQPEGEAPELGSPMGFPVTALESADDSLF DAPPVMLDEADLLGSERLDSSVSEALPSSQTAKDSLRNKWDPYTEGEKVSFQTLSAGCNREEAVQLFFDVLVLATKDVIS VKQDVAIQNEITLTAKRGMLLSSL |
| Molecular weight | 45,52 kDa |
| Purity estimated | 90% |
| Buffer | PBS, imidazole 300mM |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Partial |
| NCBI Reference | NP_588151.1 |
| Aliases /Synonyms | Peptide -N-Glycosidase F, PNGase F, PNGaseF |
| Reference | PX-P3070 |
| Note | For research use only |
Description of Elizabethkingia miricola PNGaseF Recombinant Protein
General information on Elizabethkingia miricola PNGaseF Recombinant Protein-15000u
PNGase F is a recombinant glycosidase cloned from Elizabethkingia miricola and overexpressed in E. coli. It cleaves a complete glycan from a glycoprotein and it deaminates the asparagine to aspartic acid, but leaves the oligosaccharide undamaged. PNGase F will not eliminate oligosaccharides containing Alpha-(1, 3)-linked core fucose usually found in plant glycoproteins. A tri-peptide with the oligosaccharide-linked asparagine as the central residue is the minimal substrate for PNGase F.
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Waltteri Hosia –
Was the protein active?: Yes
Very good product. I would buy again.
Waltteri Hosia –
Was the protein active?: Yes
Very good product. I would buy again.
Waltteri Hosia –
Was the protein active?: Yes
Very good product. I would buy again.