Cart (0 Items)
Your cart is currently empty.
View ProductsDermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Insect |
| Applications | Elisa, WB |
| Product name | Dermatophagoides farinae (American house dust mite) Der f 1 allergen(Derf1) Recombinant Protein |
|---|---|
| Uniprot ID | A1YW12 |
| Uniprot link | http://www.uniprot.org/uniprot/A1YW12 |
| Origin species | Dermatophagoides farinae (American house dust mite) |
| Expression system | Eukaryotic expression |
| Sequence | MKFVLAIASLLVLSTVYARPASIKTFEEFKKAFNKNYATVEEEEVARKNFLESLKYVEAN KGAINHLSDLSLDEFKNRYLMSAEAFEQLKTQFDLNAETSACRINSVNVPSELDLRSLRT VTPIRMQGGCGSCWAFSGVAATESAYLAYRNTSLDLSEQKLVDCASQHGCHGDTIPRGIE YIQQNGVVEERSYPYVAREQQCRRPNSQHYGISNYCQIYPPDVKQIREALTQTHTAIAVIIGIKDLRAFQHYDGRTIIQHDNGYQPNYHAVNIVGYGSTQGVDYWIVRNSWDTTWGDSGYGYFQAGNNLM MIEQYPYVVIMGSHHHHHH |
| Molecular weight | 51.58 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Insect |
| Applications | ELISA,WB |
| Fragment Type | Full-length |
| NCBI Reference | A1YW12 |
| Aliases /Synonyms | Der f 1 allergen(Derf1) |
| Reference | PX-P3018 |
| Note | For research use only |
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.