Product name	Human Resistin-like alpha (HIMF) Recombinant Protein
Uniprot ID	Q9BQ08
Uniprot link	http://www.uniprot.org/uniprot/Q9BQ08
Origin species	Homo sapiens (Human)
Expression system	Eukaryotic expression
Sequence	MKTATCSLLICVFLLQLMVPVNTDGTLDIIGKKKVKELLAHQDNYPSAVRKTLSCTNVKSMSKWASCPAGMTATGCSCGFACGSWEIQNENICNCLCLIVDWAYARCCQLSLEVLFQGPDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK
Molecular weight	36 kDa
Protein delivered with Tag?	Yes
Purity estimated	85%
Buffer	Tris-HCl 0.1M, Glycine 0.1M, pH8.5
Form	Frozen
Delivery condition	Dry Ice
Delivery lead time in business days	10-25
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Mammalian cells
Applications	ELISA,WB
Fragment Type	Full-length
NCBI Reference	Q9BQ08
Aliases /Synonyms	Resistin-like beta, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, RELMbeta
Reference	PX-P3011
Note	For research use only

No Products found