Size	100ug, 50ug
Brand	ProteoGenix
Product type	Recombinant Proteins
Host Species	Escherichia coli (E. coli)
Applications	Elisa, WB

Product name	Human eIF4G Recombinant Protein
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Sequence	MGSHHHHHHSGMSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAESEGSGVPPRPEEADETWDSKEDKIHNAENIQPGEQKYEYKSDQWKPLNLEEKKRYDREFLLGFQFIFASMQKPEGLPHISDVVLDKANK
Molecular weight	23.49kDa
Protein delivered with Tag?	N-ter His&Trx Tag
Purity estimated	≥95%
Buffer	PBS, imidazole 200mM + 50% glycérol
Form	liquid
Delivery condition	Dry Ice
Delivery lead time in business days	2-3
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Applications	ELISA,WB
Fragment Type	Glu557~Lys646
Protein Accession	EAW78268.1
NCBI Reference	WP_001583586
Aliases /Synonyms	EIF-4G1, EIF4F, EIF4G, EIF4GI, P220, PARK18
Reference	PX-P2069
Note	For research use only

Datasheet Download

MSDS Download

Publication

1: Nichols N, Bras JM, Hernandez DG, Jansen IE, Lesage S, Lubbe S, Singleton AB; International Parkinson's Disease Genomics Consortium.. EIF4G1 mutations do not cause Parkinson's disease. Neurobiol Aging. 2015 Aug;36(8):2444.e1-4. doi: 10.1016/j.neurobiolaging.2015.04.017. Epub 2015 May 9. PubMed PMID: 26022768; PubMed Central PMCID: PMC4464946.
2: Deng H, Wu Y, Jankovic J. The EIF4G1 gene and Parkinson's disease. Acta Neurol Scand. 2015 Aug;132(2):73-8. doi: 10.1111/ane.12397. Epub 2015 Mar 13. Review. PubMed PMID: 25765080.
3: Huttenlocher J, Krüger R, Capetian P, Lohmann K, Brockmann K, Csoti I, Klein C, Berg D, Gasser T, Bonin M, Riess O, Bauer P. EIF4G1 is neither a strong nor a common risk factor for Parkinson's disease: evidence from large European cohorts. J Med Genet. 2015 Jan;52(1):37-41. doi: 10.1136/jmedgenet-2014-102570. Epub 2014 Nov 3. PubMed PMID: 25368108.
4: Akabayov SR, Akabayov B, Wagner G. Human translation initiation factor eIF4G1 possesses a low-affinity ATP binding site facing the ATP-binding cleft of eIF4A in the eIF4G/eIF4A complex. Biochemistry. 2014 Oct 21;53(41):6422-5. doi: 10.1021/bi500600m. Epub 2014 Oct 8. PubMed PMID: 25255371; PubMed Central PMCID: PMC4204880.
5: Attar-Schneider O, Drucker L, Zismanov V, Tartakover-Matalon S, Lishner M. Targeting eIF4GI translation initiation factor affords an attractive therapeutic strategy in multiple myeloma. Cell Signal. 2014 Sep;26(9):1878-87. doi: 10.1016/j.cellsig.2014.05.005. Epub 2014 May 9. PubMed PMID: 24815186.
6: Nishioka K, Funayama M, Vilariño-Güell C, Ogaki K, Li Y, Sasaki R, Kokubo Y, Kuzuhara S, Kachergus JM, Cobb SA, Takahashi H, Mizuno Y, Farrer MJ, Ross OA, Hattori N. EIF4G1 gene mutations are not a common cause of Parkinson's disease in the Japanese population. Parkinsonism Relat Disord. 2014 Jun;20(6):659-61. doi: 10.1016/j.parkreldis.2014.03.004. Epub 2014 Mar 18. PubMed PMID: 24704100; PubMed Central PMCID: PMC4034257.
7: Blanckenberg J, Ntsapi C, Carr JA, Bardien S. EIF4G1 R1205H and VPS35 D620N mutations are rare in Parkinson's disease from South Africa. Neurobiol Aging. 2014 Feb;35(2):445.e1-3. doi: 10.1016/j.neurobiolaging.2013.08.023. Epub 2013 Sep 27. PubMed PMID: 24080171.
8: Li K, Tang BS, Guo JF, Lou MX, Lv ZY, Liu ZH, Tian Y, Song CY, Xia K, Yan XX. Analysis of EIF4G1 in ethnic Chinese. BMC Neurol. 2013 Apr 26;13:38. doi: 10.1186/1471-2377-13-38. PubMed PMID: 23617574; PubMed Central PMCID: PMC3663786.
9: Yuan L, Song Z, Xu H, Gu S, Zhu A, Gong L, Zhao Y, Deng H. EIF4G1 Ala502Val and Arg1205His variants in Chinese patients with Parkinson disease. Neurosci Lett. 2013 May 24;543:69-71. doi: 10.1016/j.neulet.2013.02.056. Epub 2013 Apr 2. PubMed PMID: 23562511.
10: Siitonen A, Majounie E, Federoff M, Ding J, Majamaa K, Singleton AB. Mutations in EIF4G1 are not a common cause of Parkinson's disease. Eur J Neurol. 2013 Apr;20(4):e59. doi: 10.1111/ene.12051. PubMed PMID: 23490116.
11: Dobrikov MI, Dobrikova EY, Gromeier M. Dynamic regulation of the translation initiation helicase complex by mitogenic signal transduction to eukaryotic translation initiation factor 4G. Mol Cell Biol. 2013 Mar;33(5):937-46. doi: 10.1128/MCB.01441-12. Epub 2012 Dec 21. PubMed PMID: 23263986; PubMed Central PMCID: PMC3623071.
12: Fujioka S, Sundal C, Strongosky AJ, Castanedes MC, Rademakers R, Ross OA, Vilariño-Güell C, Farrer MJ, Wszolek ZK, Dickson DW. Sequence variants in eukaryotic translation initiation factor 4-gamma (eIF4G1) are associated with Lewy body dementia. Acta Neuropathol. 2013 Mar;125(3):425-38. doi: 10.1007/s00401-012-1059-4. Epub 2012 Nov 4. PubMed PMID: 23124435; PubMed Central PMCID: PMC3580022.
13: Badura M, Braunstein S, Zavadil J, Schneider RJ. DNA damage and eIF4G1 in breast cancer cells reprogram translation for survival and DNA repair mRNAs. Proc Natl Acad Sci U S A. 2012 Nov 13;109(46):18767-72. doi: 10.1073/pnas.1203853109. Epub 2012 Oct 29. PubMed PMID: 23112151; PubMed Central PMCID: PMC3503184.
14: Zhao Y, Ho P, Prakash KM, Foo JN, Liu JJ, Au WL, Tan LC, Tan EK. Analysis of EIF4G1 in Parkinson's disease among Asians. Neurobiol Aging. 2013 Apr;34(4):1311.e5-6. doi: 10.1016/j.neurobiolaging.2012.09.003. Epub 2012 Oct 23. PubMed PMID: 23092605.
15: Kumar KR, Lohmann K, Klein C. Genetics of Parkinson disease and other movement disorders. Curr Opin Neurol. 2012 Aug;25(4):466-74. doi: 10.1097/WCO.0b013e3283547627. Review. PubMed PMID: 22772876.
16: Schulte EC, Mollenhauer B, Zimprich A, Bereznai B, Lichtner P, Haubenberger D, Pirker W, Brücke T, Molnar MJ, Peters A, Gieger C, Trenkwalder C, Winkelmann J. Variants in eukaryotic translation initiation factor 4G1 in sporadic Parkinson's disease. Neurogenetics. 2012 Aug;13(3):281-5. doi: 10.1007/s10048-012-0334-9. Epub 2012 Jun 16. PubMed PMID: 22707335.
17: Lesage S, Condroyer C, Klebe S, Lohmann E, Durif F, Damier P, Tison F, Anheim M, Honoré A, Viallet F, Bonnet AM, Ouvrard-Hernandez AM, Vidailhet M, Durr A, Brice A; French Parkinson's Disease Genetics Study Group.. EIF4G1 in familial Parkinson's disease: pathogenic mutations or rare benign variants? Neurobiol Aging. 2012 Sep;33(9):2233.e1-2233.e5. doi: 10.1016/j.neurobiolaging.2012.05.006. Epub 2012 Jun 1. PubMed PMID: 22658323.

Reviews

There are no reviews yet.

REVIEW YOUR PRODUCT

Be the first to review “Human eIF4G Recombinant Protein”

Price and Availability

Size

Clear

GET A QUOTE NOW

Please select the country of delivery so that we can send you the quotation including shipping costs.

Thank you for your request! You will receive your quotation per e-mail in a few seconds.

If you did not receive your quotation, please check your spam folder.

Contact us

Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.

Human eIF4G Recombinant Protein

REVIEW YOUR PRODUCT

Contact us

Cart (0 Items)