Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human ID Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Escherichia coli (E. coli) |
More info about Human ID Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1117-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human ID Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 33,38 kDa (estimate) |
| Purity estimated: | 0.5 |
| Protein accession: | NP_115515.2 |
| Spec:entrez geneid: | 84079 |
| Spec:ncbi gene aliases: | VARP, PP12899 |
| Spec:swissprotid: | Q96NW4 |
| Ncbi reference: | NP_115515.2 |
| Uniprot id: | Q96NW4 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q96NW4 |
| Aliases / synonyms: | ID, ankyrin repeat domain-containing protein 27, ANKRD27, VPS9 domain-containing protein, PP12899 |
| Protein sequence (w/o tag): | (Sequence without tag) MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHN MLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALD VVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSSTSSFSSMSASSRQ EETKKDYREVEKLLRAVADGDLEMVRYLLEWTEEDLEDAEDTVSAADPE |
| Form: | liquid |
| Buffer: | TrisHC 50mMl, pH8 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Human KELCH Recombinant Protein - Tomato Le_eIF4E1 Recombinant Protein - Tomato Le_eIFiso4E Recombinant Protein |
| Image: |  |
| Description: | Ankyrin repeat domain-containing protein 27 is a protein that in humans is encoded by the ANKRD27 gene. |
| Publications: | 1: Hesketh GG, Pérez-Dorado I, Jackson LP, Wartosch L, Schäfer IB, Gray SR, McCoy AJ, Zeldin OB, Garman EF, Harbour ME, Evans PR, Seaman MN, Luzio JP, Owen DJ. VARP is recruited on to endosomes by direct interaction with retromer, where together they function in export to the cell surface. Dev Cell. 2014 Jun 9;29(5):591-606. doi: 10.1016/j.devcel.2014.04.010. Epub 2014 May 22. PubMed PMID: 24856514; PubMed Central PMCID: PMC4059916. 2: Schäfer IB, Hesketh GG, Bright NA, Gray SR, Pryor PR, Evans PR, Luzio JP, Owen DJ. The binding of Varp to VAMP7 traps VAMP7 in a closed, fusogenically inactive conformation. Nat Struct Mol Biol. 2012 Dec;19(12):1300-9. doi: 10.1038/nsmb.2414. Epub 2012 Oct 28. PubMed PMID: 23104059; PubMed Central PMCID: PMC3605791. 3: Wang F, Zhang H, Zhang X, Wang Y, Ren F, Zhang X, Zhai Y, Chang Z. Varp interacts with Rab38 and functions as its potential effector. Biochem Biophys Res Commun. 2008 Jul 18;372(1):162-7. doi: 10.1016/j.bbrc.2008.05.017. Epub 2008 May 12. PubMed PMID: 18477474. 4: Yatsu A, Shimada H, Ohbayashi N, Fukuda M. Rab40C is a novel Varp-binding protein that promotes proteasomal degradation of Varp in melanocytes. Biol Open. 2015 Feb 6;4(3):267-75. doi: 10.1242/bio.201411114. PubMed PMID: 25661869; PubMed Central PMCID: PMC4359733. 5: Sleiman PM, Wang ML, Cianferoni A, Aceves S, Gonsalves N, Nadeau K, Bredenoord AJ, Furuta GT, Spergel JM, Hakonarson H. GWAS identifies four novel eosinophilic esophagitis loci. Nat Commun. 2014 Nov 19;5:5593. doi: 10.1038/ncomms6593. PubMed PMID: 25407941; PubMed Central PMCID: PMC4238044. 6: Zhang X, He X, Fu XY, Chang Z. Varp is a Rab21 guanine nucleotide exchange factor and regulates endosome dynamics. J Cell Sci. 2006 Mar 15;119(Pt 6):1053-62. PubMed PMID: 16525121. 7: Burgo A, Proux-Gillardeaux V, Sotirakis E, Bun P, Casano A, Verraes A, Liem RK, Formstecher E, Coppey-Moisan M, Galli T. A molecular network for the transport of the TI-VAMP/VAMP7 vesicles from cell center to periphery. Dev Cell. 2012 Jul 17;23(1):166-80. doi: 10.1016/j.devcel.2012.04.019. Epub 2012 Jun 14. PubMed PMID: 22705394. 8: Burgo A, Sotirakis E, Simmler MC, Verraes A, Chamot C, Simpson JC, Lanzetti L, Proux-Gillardeaux V, Galli T. Role of Varp, a Rab21 exchange factor and TI-VAMP/VAMP7 partner, in neurite growth. EMBO Rep. 2009 Oct;10(10):1117-24. doi: 10.1038/embor.2009.186. Epub 2009 Sep 11. PubMed PMID: 19745841; PubMed Central PMCID: PMC2759737. 9: GENDEP Investigators.; MARS Investigators.; STAR*D Investigators.. Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies. Am J Psychiatry. 2013 Feb;170(2):207-17. doi: 10.1176/appi.ajp.2012.12020237. PubMed PMID: 23377640. 10: Wan D, Gong Y, Qin W, Zhang P, Li J, Wei L, Zhou X, Li H, Qiu X, Zhong F, He L, Yu J, Yao G, Jiang H, Qian L, Yu Y, Shu H, Chen X, Xu H, Guo M, Pan Z, Chen Y, Ge C, Yang S, Gu J. Large-scale cDNA transfection screening for genes related to cancer development and progression. Proc Natl Acad Sci U S A. 2004 Nov 2;101(44):15724-9. Epub 2004 Oct 21. Erratum in: Proc Natl Acad Sci U S A. 2004 Dec 14:101(50):17565. PubMed PMID: 15498874; PubMed Central PMCID: PMC524842. 11: Simpson JC, Wellenreuther R, Poustka A, Pepperkok R, Wiemann S. Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing. EMBO Rep. 2000 Sep;1(3):287-92. PubMed PMID: 11256614; PubMed Central PMCID: PMC1083732. 12: Colland F, Jacq X, Trouplin V, Mougin C, Groizeleau C, Hamburger A, Meil A, Wojcik J, Legrain P, Gauthier JM. Functional proteomics mapping of a human signaling pathway. Genome Res. 2004 Jul;14(7):1324-32. PubMed PMID: 15231748; PubMed Central PMCID: PMC442148. 13: Mehrle A, Rosenfelder H, Schupp I, del Val C, Arlt D, Hahne F, Bechtel S, Simpson J, Hofmann O, Hide W, Glatting KH, Huber W, Pepperkok R, Poustka A, Wiemann S. The LIFEdb database in 2006. Nucleic Acids Res. 2006 Jan 1;34(Database issue):D415-8. PubMed PMID: 16381901; PubMed Central PMCID: PMC1347501. 14: Wiemann S, Arlt D, Huber W, Wellenreuther R, Schleeger S, Mehrle A, Bechtel S, Sauermann M, Korf U, Pepperkok R, Sültmann H, Poustka A. From ORFeome to biology: a functional genomics pipeline. Genome Res. 2004 Oct;14(10B):2136-44. PubMed PMID: 15489336; PubMed Central PMCID: PMC528930. 15: Wiemann S, Weil B, Wellenreuther R, Gassenhuber J, Glassl S, Ansorge W, Böcher M, Blöcker H, Bauersachs S, Blum H, Lauber J, Düsterhöft A, Beyer A, Köhrer K, Strack N, Mewes HW, Ottenwälder B, Obermaier B, Tampe J, Heubner D, Wambutt R, Korn B, Klein M, Poustka A. Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs. Genome Res. 2001 Mar;11(3):422-35. PubMed PMID: 11230166; PubMed Central PMCID: PMC311072. |