Human GSTP1 Recombinant Protein View larger

Human GSTP1 Recombinant Protein

PX-P1105-10

New product

178,04 € tax excl.

10 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Human GSTP1 Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesHuman
Host speciesEscherichia coli (E. coli)

More info about Human GSTP1 Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P1105-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Human GSTP1 Recombinant Protein
Fragment type: Full-length
Origin species: Human
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 25,02 kDa
Purity estimated: >95%
Protein accession: NP_000843.1
Spec:entrez geneid: 2950
Spec:ncbi gene aliases: DFN7, GST3, GSTP, HEL-S-22, FAEES3, PI
Spec:swissprotid: P09211
Ncbi reference: NP_000843.1
Uniprot id: P09211
Uniprot link: http://www.uniprot.org/uniprot/P09211
Aliases / synonyms: GSTP1, glutathione S-transferase P
Protein sequence (w/o tag): MAHNHRHKHKLPRAMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQS NTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVG DQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ
Form: liquid
Buffer: PBS, imidazole 250mM
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Human 3C Protease Recombinant Enzyme (GST tag)
- Human 3C Protease Recombinant Enzyme
- Tobacco TEV Protease Recombinant Enzyme

Reviews

Buy Human GSTP1 Recombinant Protein now

Add to cart