PX-P1105-10
New product
Availability date:
Brand | ProteoGenix |
Product type | Proteins |
Origin species | Human |
Host species | Escherichia coli (E. coli) |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P1105-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Human GSTP1 Recombinant Protein |
Fragment type: | Full-length |
Origin species: | Human |
Expression system: | Prokaryotic expression |
Host species: | Escherichia coli (E. coli) |
Molecular weight with tag if any: | 25,02 kDa |
Purity estimated: | >95% |
Protein accession: | NP_000843.1 |
Spec:entrez geneid: | 2950 |
Spec:ncbi gene aliases: | DFN7, GST3, GSTP, HEL-S-22, FAEES3, PI |
Spec:swissprotid: | P09211 |
Ncbi reference: | NP_000843.1 |
Uniprot id: | P09211 |
Uniprot link: | http://www.uniprot.org/uniprot/P09211 |
Aliases / synonyms: | GSTP1, glutathione S-transferase P |
Protein sequence (w/o tag): | MAHNHRHKHKLPRAMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQS NTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVG DQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
Form: | liquid |
Buffer: | PBS, imidazole 250mM |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | Dry Ice |
Delivery lead time in business days: | 10-25 |
Related products: | - Human 3C Protease Recombinant Enzyme (GST tag) - Human 3C Protease Recombinant Enzyme - Tobacco TEV Protease Recombinant Enzyme |