Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein View larger

Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein

New product

178,04 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein

BrandProteoGenix
Product typeProteins
Origin speciesToxoplasma gondii
Host speciesEscherichia coli (E. coli)

More info about Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein

Brand: ProteoGenix
Proteogenix reference: PX-P1100-10
Protein delivered with tag?: Yes
Size: 10 ug
Product name: Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein
Fragment type: Partial
Origin species: Toxoplasma gondii
Expression system: Prokaryotic expression
Host species: Escherichia coli (E. coli)
Molecular weight with tag if any: 11,54 kDa
Purity estimated: 0.9
Protein accession: BAE86889.1
Spec:swissprotid: Q25C69
Ncbi reference: BAE86889.1
Uniprot id: Q25C69
Uniprot link: http://www.uniprot.org/uniprot/Q25C69
Aliases / synonyms: GRA6Ct(174-230)(RH), dense granule antigen
Protein sequence (w/o tag): MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTTGRRSPQEPSGDGGGNDAGNNAGNGGNEGRGYGGRGEGGAED DRRPLHPERVNVFDYKLAAALEHHHHHH
Form: liquid
Buffer: PBS, imidazole 300mM
Storage condition: 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Delivery condition: Dry Ice
Delivery lead time in business days: 10-25
Related products: - Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein
- Toxoplasma gondii GRA6Nt(41-152)(RH) Recombinant Protein
- Schistosoma GST Recombinant Protein

Reviews

Buy Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein now

Add to cart