Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Toxoplasma gondii |
| Host species | Escherichia coli (E. coli) |
More info about Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1098-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Toxoplasma gondii GRA6Ct(174-224)(76K) Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Toxoplasma gondii |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 10,80 kDa |
| Purity estimated: | 0.9 |
| Protein accession: | CAG25735.1 |
| Spec:swissprotid: | Q1RS40 |
| Ncbi reference: | CAG25735.1 |
| Uniprot id: | Q1RS40 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q1RS40 |
| Aliases / synonyms: | GRA6Ct(174-224)(76K), dense granule antigen |
| Protein sequence (w/o tag): | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTTGRRSPQEPSGGGGGNDAGNNAGNGGNEGRGEGGEDDRRPLH PGSVNEFDFKLAAALEHHHHHH |
| Form: | liquid |
| Buffer: | PBS, imidazole 300mM if native conditions. PBS, imidazole 400mM, Urea 8M if denaturing conditions |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Toxoplasma gondii GRA6Ct(174-230)(C56) Recombinant Protein - Toxoplasma gondii GRA6Ct(174-230)(RH) Recombinant Protein - Toxoplasma gondii GRA6Nt(41-152)(76K) Recombinant Protein |