PX-P1094-10
New product
Availability date:
Brand | ProteoGenix |
Product type | Proteins |
Origin species | Toxoplasma gondii |
Host species | Escherichia coli (E. coli) |
Brand: | ProteoGenix |
Proteogenix reference: | PX-P1094-10 |
Protein delivered with tag?: | Yes |
Size: | 10 ug |
Product name: | Toxoplasma gondii GRA2(21-185)(76K) Recombinant Protein |
Fragment type: | Partial |
Origin species: | Toxoplasma gondii |
Expression system: | Prokaryotic expression |
Host species: | Escherichia coli (E. coli) |
Molecular weight with tag if any: | 25,78 kDa |
Purity estimated: | 0.8 |
Protein accession: | XP_002366395.1 |
Spec:entrez geneid: | 7897424 |
Spec:swissprotid: | S8EXV7 |
Ncbi reference: | XP_002366395.1 |
Uniprot id: | B6KEX2 |
Uniprot link: | http://www.uniprot.org/uniprot/B6KEX2 |
Aliases / synonyms: | GRA2(21-185)(76K), 28kd antigen |
Protein sequence (w/o tag): | MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKSPGFSSTMGMRAAEFSGVVNQGPVDVPFSGKPLDERA VGGKGEHTPPLPDERQQEPEEPVSQRASRVAEQLFRKFLKFAENVGQHSEKAFKKAKVVAEKGFTAAKTHTVRGFKVAKE AAGRGMVTVGKKLANVESDRSTTTTQAPDSPNGLAETQAPVEPQQRAAHVPVPDFSQSDPNSSSVDKLAAALEHHHHHH |
Form: | liquid |
Buffer: | PBS, imidazole 300mM |
Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
Delivery condition: | Dry Ice |
Delivery lead time in business days: | 10-25 |
Related products: | - Toxoplasma gondii GRA2(21-185)(RH) Recombinant Protein - Toxoplasma gondii GRA2(Nt-Ct) (RH) Recombinant Protein - Toxoplasma gondii GRA6(43-230)(RH) Recombinant Protein |