Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Leishmania CPB Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Leishmania |
| Host species | Escherichia coli (E. coli) |
More info about Leishmania CPB Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1082-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Leishmania CPB Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Leishmania |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 18,82 kDa |
| Purity estimated: | 0.9 |
| Protein accession: | XP_001463431.1 |
| Spec:entrez geneid: | 5066816 |
| Spec:swissprotid: | A4HTP0 |
| Ncbi reference: | XP_001463431.1 |
| Uniprot id: | A4HTP0 |
| Uniprot link: | http://www.uniprot.org/uniprot/A4HTP0 |
| Aliases / synonyms: | CPB, Cathepsin L-like Protease |
| Protein sequence (w/o tag): | MAHNHRHKHKLMATSRAALCAVAVVCVVLAAACAPARAIYVGTPAAALFEEFKRTYRRAYGTLAEEQQRLANFERNLELM REHQARNPHARFGITKFFDLSEAEFAARYLNGAAYFAAAKQHAGQHYRKARADLSAVPDAVDWREKGAVTPVKDQGACGS CWAFSAVGNIE |
| Form: | liquid |
| Buffer: | PBS, Urea 8M |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Clostridium Cwp84 Recombinant Protein - Human DJ1 Recombinant Protein - Human Efa_120 Recombinant Protein |