Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Rat CFMNter Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Rat |
| Host species | Escherichia coli (E. coli) |
More info about Rat CFMNter Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1079-10 |
| Protein delivered with tag?: | No |
| Size: | 10 ug |
| Product name: | Rat CFMNter Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Rat |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 12,82 kDa |
| Purity estimated: | 80% (with degraded bands) |
| Protein accession: | NP_001007612.1 |
| Spec:entrez geneid: | 287534 |
| Spec:ncbi gene aliases: | RGD1359691 |
| Spec:swissprotid: | Q6AXS9 |
| Ncbi reference: | NP_001007612.1 |
| Uniprot id: | Q6AXS9 |
| Uniprot link: | http://www.uniprot.org/uniprot/Q6AXS9 |
| Aliases / synonyms: | CFMNter, protein FAM101B, Refilin-B, Regulator of filamin protein B, RefilinB |
| Protein sequence (w/o tag): | GPLGSMVGRLSLQDVPELVDTKKKGDGVLDSPDSGLPPSPSPSHWGLAAATGGGGERAPVAGTLEPDATVTSVVPNPASL SHSLAGICSPRLCPLSFGEGVEFDPLPPKEIKYTSSVKYDSERHF |
| Form: | liquid |
| Buffer: | TrisHCl 50mM if elution. TrisHCl 50mM, NaCl 150mM, EDTA 1mM, DTT 1mM if cleavage |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Human Chuck Recombinant Protein - Human COL11A Recombinant Protein - Leishmania CPB Recombinant Protein |