Cart (0 Items)
Your cart is currently empty.
View ProductsChilli Ca_eIF4E1 Recombinant Protein
| size | 100ug, 50ug |
|---|---|
| Brand | ProteoGenix |
| Product type | Recombinant Proteins |
| Host Species | Escherichia coli (E. coli) |
| Applications | Elisa, WB |
| Product name | Chilli Ca_eIF4E1 Recombinant Protein |
|---|---|
| Uniprot ID | Q8GSF9 |
| Uniprot link | http://www.uniprot.org/uniprot/Q8GSF9 |
| Origin species | Chilli |
| Expression system | Prokaryotic expression |
| Sequence | MGSSHHHHHHSSGLVPRGSHMMATAEMEKTTTFDEAEKVKLNANEADDEVEEGEIVEETDDTTSYLSKEIATKHPLEHSW TFWFDNPVAKSKQAAWGSSLRNVYTFSTVEDFWGAYNNIHHPSKLVVGADLHCFKHKIEPKWEDPVCANGGTWKMSFSKG KSDTSWLYTLLAMIGHQFDHEDEICGAVVSVRGKGEKISLWTKNAANETAQVSIGKQWKQFLDYSDSVGFIFHDDAKRLD RNAKNRYTV |
| Molecular weight | 28,15 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | ≥90% |
| Buffer | PBS1x, Urea 8M |
| Form | liquid |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 10-25 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Applications | ELISA,WB |
| Fragment Type | Full-length |
| Protein Accession | AAN74644.1 |
| Spec:SwissProtID | Q8GSF9 |
| NCBI Reference | AAN74644.1 |
| Aliases /Synonyms | Ca_eIF4E1, eucaryotic initiation factor 4E, Eukaryotic translation initiation factor 4E |
| Reference | PX-P1077 |
| Note | For research use only |
Description of Chilli Ca_eIF4E1 Recombinant Protein
General information on Chilli Ca_eIF4E1 Recombinant Protein:
eIF4E1 Recombinant Protein from Capsicum annuum (Bell pepper) is a central element of the initiation complex of mRNA translation in eukaryotes. The eIF4E gene is coexpressed with the Tobacco etch virus (TEV) genome, it exerts a positive effect on viral amplification.
Contact us
Got a question or need a quote?
Message us and we’ll get back to you 48 hours or less.
Reviews
There are no reviews yet.