Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human CD36 (AA 104-294) Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Escherichia coli (E. coli) |
More info about Human CD36 (AA 104-294) Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1061-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human CD36 (AA 104-294) Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 22,73 kDa |
| Purity estimated: | 0.8 |
| Protein accession: | AAA16068.1 |
| Spec:entrez geneid: | 948 |
| Spec:ncbi gene aliases: | CHDS7, GPIV, PASIV, FAT, SCARB3, GP3B, BDPLT10, GP4 |
| Spec:swissprotid: | P16671 |
| Ncbi reference: | AAA16068.1 |
| Uniprot id: | P16671 |
| Uniprot link: | http://www.uniprot.org/uniprot/P16671 |
| Aliases / synonyms: | CD36 (AA 104-294), antigen CD36, Platelet glycoprotein 4, Fatty acid translocase, FAT, Glycoprotein IIIb, GPIIIB, Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV, GPIV, Thrombospondin receptor, CD_antigen: CD36, GP3B, GP4 |
| Protein sequence (w/o tag): | MAHNHRHKHKLTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQV RTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAA SFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRF |
| Form: | liquid |
| Buffer: | PBS, imidazole 300mM, Urea 8M, pH7.4 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Human UHRF1(400-660) Recombinant Protein - Human UHRF1(290-660) Recombinant Protein - Leishmania CPACter Recombinant Protein |
| Image: |  |
| Description: | CD36 is an integral membrane glycoprotein that has many physiological functions; it is a protein that in humans is encoded by the CD36 gene. As a part of the scavenger receptor family, CD36 is a multi-ligand pattern recognition receptor that binds multiples ligands including long chain fatty acid (LCFA), oxidized low-density lipoproteins (oxLDLs), high density lipoprotein (HDL), phosphatidylserine, apoptotic cells, collagens I and IV, and Plasmodium falciparum-infected erythrocytes etc. CD36 plays a role in the initiation and pathogenesis of chronic inflammatory diseases such as Alzheimer’s disease and atherosclerosis. |
| Publications: | 1: Å erý O, Janoutová J, Ewerlingová L, Hálová A, Lochman J, Janout V, Khan NA, Balcar VJ. CD36 gene polymorphism is associated with Alzheimer's disease. Biochimie. 2017 Apr;135:46-53. doi: 10.1016/j.biochi.2017.01.009. Epub 2017 Jan 20. PubMed PMID: 28111291. 2: Sini S, Deepa D, Harikrishnan S, Jayakumari N. High-density lipoprotein from subjects with coronary artery disease promotes macrophage foam cell formation: role of scavenger receptor CD36 and ERK/MAPK signaling. Mol Cell Biochem. 2017 Mar;427(1-2):23-34. doi: 10.1007/s11010-016-2895-7. Epub 2016 Dec 19. PubMed PMID: 27995417. 3: Pascual G, Avgustinova A, Mejetta S, MartÃn M, Castellanos A, Attolini CS, Berenguer A, Prats N, Toll A, Hueto JA, Bescós C, Di Croce L, Benitah SA. Targeting metastasis-initiating cells through the fatty acid receptor CD36. Nature. 2017 Jan 5;541(7635):41-45. doi: 10.1038/nature20791. Epub 2016 Dec 7. PubMed PMID: 27974793. 4: Kalai M, Dridi M, Chaouch L, Moumni I, Ouragini H, Darragi I, Boudrigua I, Chaouachi D, Mellouli F, Bejaoui M, Abbes S. The role of rs1984112_G at CD36 gene in increasing reticulocyte level among sickle cell disease patients. Hematology. 2017 Apr;22(3):178-182. doi: 10.1080/10245332.2016.1253253. Epub 2016 Nov 20. PubMed PMID: 27869039. 5: Jayewardene AF, Mavros Y, Gwinn T, Hancock DP, Rooney KB. Associations between CD36 gene polymorphisms and metabolic response to a short-term endurance-training program in a young-adult population. Appl Physiol Nutr Metab. 2016 Feb;41(2):157-67. doi: 10.1139/apnm-2015-0430. Epub 2015 Oct 22. PubMed PMID: 26830498. 6: Daoudi H, PlesnÃk J, Sayed A, Å erý O, Rouabah A, Rouabah L, Khan NA. Oral Fat Sensing and CD36 Gene Polymorphism in Algerian Lean and Obese Teenagers. Nutrients. 2015 Nov 4;7(11):9096-104. doi: 10.3390/nu7115455. PubMed PMID: 26556365; PubMed Central PMCID: PMC4663583. 7: Lo SC, Lin KH, Hsieh HH, Lin DT, Hu CY. Genetic variations of CD36 and low platelet CD36 expression - a risk factor for lipemic plasma donation in Taiwanese apheresis donors. Vox Sang. 2016 Apr;110(3):236-43. doi: 10.1111/vox.12356. Epub 2015 Nov 3. PubMed PMID: 26528880. 8: Hou Y, Wu M, Wei J, Ren Y, Du C, Wu H, Li Y, Shi Y. CD36 is involved in high glucose-induced epithelial to mesenchymal transition in renal tubular epithelial cells. Biochem Biophys Res Commun. 2015 Dec 4-11;468(1-2):281-6. doi: 10.1016/j.bbrc.2015.10.112. Epub 2015 Oct 24. PubMed PMID: 26505798. 9: Nath A, Li I, Roberts LR, Chan C. Elevated free fatty acid uptake via CD36 promotes epithelial-mesenchymal transition in hepatocellular carcinoma. Sci Rep. 2015 Oct 1;5:14752. doi: 10.1038/srep14752. PubMed PMID: 26424075; PubMed Central PMCID: PMC4589791. 10: Sundaresan S, Abumrad NA. Dietary Lipids Inform the Gut and Brain about Meal Arrival via CD36-Mediated Signal Transduction. J Nutr. 2015 Oct;145(10):2195-200. doi: 10.3945/jn.115.215483. Epub 2015 Aug 12. Review. PubMed PMID: 26269236; PubMed Central PMCID: PMC4580959. 11: Schörghofer D, Kinslechner K, Preitschopf A, Schütz B, Röhrl C, Hengstschläger M, Stangl H, Mikula M. The HDL receptor SR-BI is associated with human prostate cancer progression and plays a possible role in establishing androgen independence. Reprod Biol Endocrinol. 2015 Aug 7;13:88. doi: 10.1186/s12958-015-0087-z. PubMed PMID: 26251134; PubMed Central PMCID: PMC4528807. 12: Allum F, Shao X, Guénard F, Simon MM, Busche S, Caron M, Lambourne J, Lessard J, Tandre K, Hedman Ã…K, Kwan T, Ge B; Multiple Tissue Human Expression Resource Consortium., Rönnblom L, McCarthy MI, Deloukas P, Richmond T, Burgess D, Spector TD, Tchernof A, Marceau S, Lathrop M, Vohl MC, Pastinen T, Grundberg E. Characterization of functional methylomes by next-generation capture sequencing identifies novel disease-associated variants. Nat Commun. 2015 May 29;6:7211. doi: 10.1038/ncomms8211. Erratum in: Nat Commun. 2015;6:8016. PubMed PMID: 26021296; PubMed Central PMCID: PMC4544751. 13: Krzystolik A, Dziedziejko V, Safranow K, Kurzawski G, Rać M, Sagasz-Tysiewicz D, Poncyljusz W, Jakubowska K, Chlubek D, Rać ME. Is plasma soluble CD36 associated with cardiovascular risk factors in early onset coronary artery disease patients? Scand J Clin Lab Invest. 2015 Sep;75(5):398-406. doi: 10.3109/00365513.2015.1031693. Epub 2015 Apr 28. PubMed PMID: 25916834. 14: Mrizak I, Å erý O, Plesnik J, Arfa A, Fekih M, Bouslema A, Zaouali M, Tabka Z, Khan NA. The A allele of cluster of differentiation 36 (CD36) SNP 1761667 associates with decreased lipid taste perception in obese Tunisian women. Br J Nutr. 2015 Apr 28;113(8):1330-7. doi: 10.1017/S0007114515000343. Epub 2015 Mar 30. PubMed PMID: 25822988. 15: Melis M, Sollai G, Muroni P, Crnjar R, Barbarossa IT. Associations between orosensory perception of oleic acid, the common single nucleotide polymorphisms (rs1761667 and rs1527483) in the CD36 gene, and 6-n-propylthiouracil (PROP) tasting. Nutrients. 2015 Mar 20;7(3):2068-84. doi: 10.3390/nu7032068. PubMed PMID: 25803547; PubMed Central PMCID: PMC4377901. |