Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Human VEGF Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Human |
| Host species | Escherichia coli (E. coli) |
More info about Human VEGF Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1060-10 |
| Protein delivered with tag?: | Yes |
| Size: | 10 ug |
| Product name: | Human VEGF Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Human |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 14,65 kDa |
| Purity estimated: | 0.7 |
| Protein accession: | AAH65522.2 |
| Spec:entrez geneid: | 7422 |
| Spec:ncbi gene aliases: | MVCD1, VPF, VEGF |
| Spec:swissprotid: | P15692 |
| Ncbi reference: | AAH65522.2 |
| Uniprot id: | P15692 |
| Uniprot link: | http://www.uniprot.org/uniprot/P15692 |
| Aliases / synonyms: | VEGF, VEGFA protein, Vascular endothelial growth factor A, VEGF-A, Vascular permeability factor, VPF, VEGFA |
| Protein sequence (w/o tag): | MAHNHRHKHKLDDDDKAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDE GLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDR |
| Form: | Frozen |
| Buffer: | PBS,pH 7.5 urea +8M |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Human CD36 (AA 104-294) Recombinant Protein - Human UHRF1(400-660) Recombinant Protein - Human UHRF1(290-660) Recombinant Protein |
| Image: | .jpg) |
| Description: | VEGF (Vascular endothelial growth factor) Recombinant Protein was initially isolated from tumor cells and assigned to as Tumor Angiogenesis Factor or Vascular Permeability Factor. It is a homodimeric protein intended for use in cell culture applications. It stimulates vasculogenesis and angiogenesis. They are part of the system that reestablishes the oxygen supply to tissues when blood circulation is insufficient. VEGFA can operate as a proinflammatory mediator during the pathogenesis of rheumatoid arthritis (RA), and preserve rheumatoid synoviocytes from apoptosis, which provides to synovial hyperplasia. |
| Publications: | 1: Burmeister K, Quagliata L, Andreozzi M, Eppenberger-Castori S, Matter MS, Perrina V, Grobholz R, Jochum W, Horber D, Moosmann P, Lehmann F, Köberle D, Ng CK, Piscuoglio S, Tornillo L, Terracciano LM. Vascular endothelial growth factor A amplification in colorectal cancer is associated with reduced M1 and M2 macrophages and diminished PD-1-expressing lymphocytes. PLoS One. 2017 Apr 12;12(4):e0175563. doi: 10.1371/journal.pone.0175563. eCollection 2017. PubMed PMID: 28403223; PubMed Central PMCID: PMC5389821. 2: Yin J, Shen L, Ji M, Wu Y, Cai S, Chen J, Yao Z, Ge J. Inverse Relationship between Serum VEGF Levels and Late In-Stent Restenosis of Drug-Eluting Stents. Biomed Res Int. 2017;2017:8730271. doi: 10.1155/2017/8730271. Epub 2017 Mar 8. PubMed PMID: 28373989; PubMed Central PMCID: PMC5360953. 3: Ruffolo C, Toffolatti L, Canal F, Kotsafti A, Pagura G, Pozza A, Campo Dell'Orto M, Ferrara F, Massani M, Dei Tos AP, Castoro C, Bassi N, Scarpa M. Colorectal polypoid lesions and expression of vascular endothelial growth factor in a consecutive series of endoscopic and surgical patients. Tumour Biol. 2017 Mar;39(3):1010428317692263. doi: 10.1177/1010428317692263. PubMed PMID: 28347226. 4: Naykoo NA, Dil-Afroze, Rasool R, Shah S, Ahangar AG, Bhat IA, Qasim I, Siddiqi MA, Shah ZA. Single nucleotide polymorphisms, haplotype association and tumour expression of the vascular endothelial growth factor (VEGF) gene with lung carcinoma. Gene. 2017 Apr 15;608:95-102. doi: 10.1016/j.gene.2017.01.007. Epub 2017 Jan 23. PubMed PMID: 28122267. 5: Zhuo Y, Zeng Q, Zhang P, Li G, Xie Q, Cheng Y. VEGF Promoter Polymorphism Confers an Increased Risk of Pulmonary Arterial Hypertension in a Chinese Population. Yonsei Med J. 2017 Mar;58(2):305-311. doi: 10.3349/ymj.2017.58.2.305. PubMed PMID: 28120560; PubMed Central PMCID: PMC5290009. 6: Dang YZ, Zhang Y, Li JP, Hu J, Li WW, Li P, Wei LC, Shi M. High VEGFR1/2 expression levels are predictors of poor survival in patients with cervical cancer. Medicine (Baltimore). 2017 Jan;96(1):e5772. doi: 10.1097/MD.0000000000005772. PubMed PMID: 28072723; PubMed Central PMCID: PMC5228683. 7: Martynova EV, Valiullina AH, Gusev OA, Davidyuk YN, Garanina EE, Shakirova VG, Khaertynova I, Anokhin VA, Rizvanov AA, Khaiboullina SF. High Triglycerides Are Associated with Low Thrombocyte Counts and High VEGF in Nephropathia Epidemica. J Immunol Res. 2016;2016:8528270. doi: 10.1155/2016/8528270. Epub 2016 Dec 5. PubMed PMID: 28053993; PubMed Central PMCID: PMC5178363. 8: López-Cancio E, Ricciardi AC, Sobrino T, Cortés J, de la Ossa NP, Millán M, Hernández-Pérez M, Gomis M, Dorado L, Muñoz-Narbona L, Campos F, Arenillas JF, Dávalos A. Reported Prestroke Physical Activity Is Associated with Vascular Endothelial Growth Factor Expression and Good Outcomes after Stroke. J Stroke Cerebrovasc Dis. 2017 Feb;26(2):425-430. doi: 10.1016/j.jstrokecerebrovasdis.2016.10.004. Epub 2016 Oct 28. PubMed PMID: 28029607. 9: Ghazizadeh H, Fazilati M, Pasdar A, Avan A, Tayefi M, Ghasemi F, Mehramiz M, Mirhafez SR, Ferns GA, Azimi-Nezhad M, Ghayour-Mobarhan M. Association of a Vascular Endothelial Growth Factor genetic variant with Serum VEGF level in subjects with Metabolic Syndrome. Gene. 2017 Jan 20;598:27-31. doi: 10.1016/j.gene.2016.10.034. Epub 2016 Oct 27. PubMed PMID: 27984191. 10: Barchitta M, Maugeri A. Association between Vascular Endothelial Growth Factor Polymorphisms and Age-Related Macular Degeneration: An Updated Meta-Analysis. Dis Markers. 2016;2016:8486406. doi: 10.1155/2016/8486406. Epub 2016 Nov 23. PubMed PMID: 27999450; PubMed Central PMCID: PMC5141552. 11: Li J, Sun K, Chen Z, Shi J, Zhou D, Xie G. A fluorescence biosensor for VEGF detection based on DNA assembly structure switching and isothermal amplification. Biosens Bioelectron. 2017 Mar 15;89(Pt 2):964-969. doi: 10.1016/j.bios.2016.09.078. Epub 2016 Sep 30. PubMed PMID: 27816590. 12: Rotar IC, Dumitras DE, Popp RA, Petrisor FM, Cotutiu P, Stamatian F, Muresan D. VEGF +936 C/T Genetic Polymorphism in Patients with Cervical Dysplasia. Anal Cell Pathol (Amst). 2016;2016:6074275. Epub 2016 Oct 12. PubMed PMID: 27812483; PubMed Central PMCID: PMC5080462. 13: Hu ZQ, Xue H, Long JH, Wang Y, Jia Y, Qiu W, Zhou J, Wen ZY, Yao WJ, Zeng Z. Biophysical Properties and Motility of Human Mature Dendritic Cells Deteriorated by Vascular Endothelial Growth Factor through Cytoskeleton Remodeling. Int J Mol Sci. 2016 Oct 31;17(11). pii: E1756. PubMed PMID: 27809226; PubMed Central PMCID: PMC5133777. 14: Camerin GR, Brito AB, Vassallo J, Derchain SF, Lima CS. VEGF gene polymorphisms and outcome of epithelial ovarian cancer patients. Future Oncol. 2017 Feb;13(5):409-414. doi: 10.2217/fon-2016-0299. Epub 2016 Oct 26. PubMed PMID: 27780361. 15: Lee S, Kang HG, Choi JE, Lee JH, Kang HJ, Baek SA, Lee E, Seok Y, Lee WK, Lee SY, Yoo SS, Lee J, Cha SI, Kim CH, Cho S, Park JY. The Different Effect of VEGF Polymorphisms on the Prognosis of Non-Small Cell Lung Cancer according to Tumor Histology. J Korean Med Sci. 2016 Nov;31(11):1735-1741. doi: 10.3346/jkms.2016.31.11.1735. PubMed PMID: 27709850; PubMed Central PMCID: PMC5056204. |