Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of Drosophila TSH Recombinant Protein
| Brand | ProteoGenix |
| Product type | Proteins |
| Origin species | Fruit fry |
| Host species | Escherichia coli (E. coli) |
More info about Drosophila TSH Recombinant Protein
| Brand: | ProteoGenix |
| Proteogenix reference: | PX-P1054-10 |
| Protein delivered with tag?: | No |
| Size: | 10 ug |
| Product name: | Drosophila TSH Recombinant Protein |
| Fragment type: | Partial |
| Origin species: | Fruit fry |
| Expression system: | Prokaryotic expression |
| Host species: | Escherichia coli (E. coli) |
| Molecular weight with tag if any: | 19,65 kDa |
| Purity estimated: | 0.8 |
| Protein accession: | AAA28983.1 |
| Spec:entrez geneid: | 35430 |
| Spec:ncbi gene aliases: | CG1374, ae, Tsh, T shirt, l(2)B4-2-12, l(2)04319, ae[l], Dmel\CG1374 |
| Spec:swissprotid: | P22265 |
| Ncbi reference: | AAA28983.1 |
| Uniprot id: | P22265 |
| Uniprot link: | http://www.uniprot.org/uniprot/P22265 |
| Aliases / synonyms: | TSH, teashirt, Protein teashirt, CG1374 |
| Protein sequence (w/o tag): | GPLGSANSSERCPSHDSNSSEHGGGAGSGGVGHRLDAAALSTGVMPGEGPTTLHSSFPAVPQSLPSQPPSMEAYLHMVAA AAQQYGFPLAAAAAAGAGPRLPLPLANEAAAPFKLPPQASPTASSNNSEALDFRTNLYGRAESAEPPASEGEEEEFDDGA NNPLDLSVGTRKRGHESEPQLGHIQVKKMFKSD |
| Form: | liquid |
| Buffer: | 3C-protease cleavage buffer: TrisHC 50mMl, NaCl 150mM, EDTA 1mM, DTT 1mM, pH7 |
| Storage condition: | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Delivery condition: | Dry Ice |
| Delivery lead time in business days: | 10-25 |
| Related products: | - Horse P47 Recombinant Protein - Ciona intestinalis Tropomyosin Recombinant Protein - Human HSP70 Recombinant Protein |
| Image: |  |
| Description: | Protein teashirt from Drosophila melanogaster (Fruit fly) also known as TSH is initially localized in the cytoplasm soon after the blastoderm stage, and becomes nuclear by stage 9. It belongs to the teashirt C2H2-type zinc-finger protein family. It is a homeotic protein that acts downstream of Arm in the Wg cascade during embryogenesis to determine segment identity throughout the entire trunk. The protein shows a dynamic expression pattern during embryogenesis, expressed throughout embryonic, larval and adult development. TSH may play a role in wing hinge development. Possible involvement in chromatin structure for modulation of transcription. Binds DNA and can act as both a transcriptional repressor and activator. |
| Publications: | 1: Fasano L, Röder L, Coré N, Alexandre E, Vola C, Jacq B, Kerridge S. The gene teashirt is required for the development of Drosophila embryonic trunk segments and encodes a protein with widely spaced zinc finger motifs. Cell. 1991 Jan 11;64(1):63-79. PubMed PMID: 1846092. |