Catalog no.: | PAA537Hu02 |
Product name: | Polyclonal Antibody to Enolase, Neuron Specific (NSE) |
Immunogen: | NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT) |
Concentration: | 200ug/ml |
Alternative names: | ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase |
Applicable secondary antibody: | SAA544Rb59, SAA544Rb58, SAA544Rb57, SAA544Rb18, SAA544Rb19 |
Delivery condition: | 4â with ice bags |
Storage: | Avoid repeated freeze/thaw cycles. Store at 4â for frequent use. Aliquot and store at -20â for 12 months. |