Polyclonal Antibody to Enolase, Neuron Specific (NSE) View larger

Polyclonal Antibody to Enolase, Neuron Specific (NSE)

New product

101,15 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Polyclonal Antibody to Enolase, Neuron Specific (NSE)

BrandCloud Clone
Product typePrimary antibodies
ReactivityHuman
ClonalityPolyclonal
Host speciesRabbit
ApplicationsWB, ICC, IHC-P, IHC-F, ELISA

More info about Polyclonal Antibody to Enolase, Neuron Specific (NSE)

Catalog no.: PAA537Hu02
Product name: Polyclonal Antibody to Enolase, Neuron Specific (NSE)
Immunogen: NSE (Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT)
Concentration: 200ug/ml
Alternative names: ENO2, Enolase 2, Gamma Enolase, 2-phospho-D-glycerate hydro-lyase, Neural enolase
Applicable secondary antibody: SAA544Rb59, SAA544Rb58, SAA544Rb57, SAA544Rb18, SAA544Rb19
Delivery condition: 4℃ with ice bags
Storage: Avoid repeated freeze/thaw cycles. Store at 4℃ for frequent use. Aliquot and store at -20℃ for 12 months.

Reviews

Buy Polyclonal Antibody to Enolase, Neuron Specific (NSE) now

Add to cart