New product
Availability date:
Brand | Cloud Clone |
Product type | Primary antibodies |
Reactivity | Mouse |
Clonality | Polyclonal |
Host species | Rabbit |
Applications | WB, ICC, IHC-P, IHC-F, ELISA |
Catalog no.: | PAB257Mu01 |
Product name: | Polyclonal Antibody to Scavenger Receptor Class D Member 1 (SCARD1) |
Immunogen: | SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA) |
Concentration: | 200ug/ml |
Alternative names: | CD68, GP110, Macrosialin, Macrophage Antigen CD68 |
Applicable secondary antibody: | SAA544Rb59, SAA544Rb58, SAA544Rb57, SAA544Rb18, SAA544Rb19 |
Delivery condition: | 4â with ice bags |
Storage: | Avoid repeated freeze/thaw cycles. Store at 4â for frequent use. Aliquot and store at -20â for 12 months. |