New product
Availability date:
Brand | Cloud Clone |
Product type | Primary antibodies |
Reactivity | Human |
Clonality | Monoclonal |
Host species | Mouse |
Applications | WB, ICC, IHC-P, IHC-F, ELISA |
Catalog no.: | MAA537Hu22 |
Product name: | Monoclonal Antibody to Enolase, Neuron Specific (NSE) |
Concentration: | 500ug/ml |
Immunogen: | Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT |
Alternative names: | ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase |
Applicable secondary antibody: | SAA544Mu08, SAA544Mu09, SAA544Mu07, SAA544Mu19, SAA544Mu18, SAA544Mu17 |
Delivery condition: | 4â with ice bags |
Storage: | Avoid repeated freeze/thaw cycles. Store at 4 â for frequent use. Aliquot and store at -20 â for 12 months. |