Anti Human Monoclonal Antibody to Enolase, Neuron Specific (NSE) View larger

Anti Human Monoclonal Antibody to Enolase, Neuron Specific (NSE)

New product

95,71 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Anti Human Monoclonal Antibody to Enolase, Neuron Specific (NSE)

BrandCloud Clone
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB, ICC, IHC-P, IHC-F, ELISA

More info about Anti Human Monoclonal Antibody to Enolase, Neuron Specific (NSE)

Catalog no.: MAA537Hu22
Product name: Monoclonal Antibody to Enolase, Neuron Specific (NSE)
Concentration: 500ug/ml
Immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT
Alternative names: ENO2; Enolase 2; Gamma Enolase; 2-phospho-D-glycerate hydro-lyase; Neural enolase
Applicable secondary antibody: SAA544Mu08, SAA544Mu09, SAA544Mu07, SAA544Mu19, SAA544Mu18, SAA544Mu17
Delivery condition: 4℃ with ice bags
Storage: Avoid repeated freeze/thaw cycles. Store at 4 ℃ for frequent use. Aliquot and store at -20 ℃ for 12 months.

Reviews

Buy Anti Human Monoclonal Antibody to Enolase, Neuron Specific (NSE) now

Add to cart