Mouse Recombinant Activin A Receptor Type II A (ACVR2A) View larger

Mouse Recombinant Activin A Receptor Type II A (ACVR2A)

New product

181,82 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Mouse Recombinant Activin A Receptor Type II A (ACVR2A)

BrandCloud Clone
Product typeProteins
Origin speciesMouse
Host speciesEscherichia coli (E. coli)
ApplicationsSDS-PAGE, WB, ELISA, IP

More info about Mouse Recombinant Activin A Receptor Type II A (ACVR2A)

Catalog no.: RPC117Mu01
Product name : Recombinant Activin A Receptor Type II A (ACVR2A)
Uniprot id: P27038
Purity: ≥ 92%
Predicted molecular mass(kd): 18.3kDa
Fragment: Ala20~Lys95+TALKCTFVAVRAICVMKSPLIFRRWKSHSPLQILLHRSHPDSSTTTTTTEIRLLTKPERKLSWLLPPLSNN
Tag: N-terminal His-Tag
Expression system: Prokaryotic expression
Delivery condition: 4℃ with ice bags
Storage: Avoid repeated freeze/thaw cycles. Store at 4℃ for frequent use. Aliquot and store at -20℃ for 12 months.

Reviews

Buy Mouse Recombinant Activin A Receptor Type II A (ACVR2A) now

Add to cart