New product
Availability date:
Brand | Cloud Clone |
Product type | Proteins |
Origin species | Mouse |
Host species | Escherichia coli (E. coli) |
Applications | SDS-PAGE, WB, ELISA, IP |
Catalog no.: | RPC117Mu01 |
Product name : | Recombinant Activin A Receptor Type II A (ACVR2A) |
Uniprot id: | P27038 |
Purity: | ⥠92% |
Predicted molecular mass(kd): | 18.3kDa |
Fragment: | Ala20~Lys95+TALKCTFVAVRAICVMKSPLIFRRWKSHSPLQILLHRSHPDSSTTTTTTEIRLLTKPERKLSWLLPPLSNN |
Tag: | N-terminal His-Tag |
Expression system: | Prokaryotic expression |
Delivery condition: | 4â with ice bags |
Storage: | Avoid repeated freeze/thaw cycles. Store at 4â for frequent use. Aliquot and store at -20â for 12 months. |