No products
Prices are tax excluded
New product
Availability date:
Brand | Cloud Clone |
Product type | Proteins |
Origin species | Mouse |
Host species | Escherichia coli (E. coli) |
Applications | SDS-PAGE, WB, ELISA, IP |
Catalog no.: | RPB257Mu01 |
Product name : | Recombinant Scavenger Receptor Class D Member 1 (SCARD1) |
Uniprot id: | P31996 |
Purity: | ⥠95% |
Predicted molecular mass(kd): | 54.33kDa |
Fragment: | Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA |
Tag: | two N-terminal Tags, His-tag and GST-tag |
Expression system: | Prokaryotic expression |
Delivery condition: | 4â with ice bags |
Storage: | Avoid repeated freeze/thaw cycles. Store at 4â for frequent use. Aliquot and store at -20â for 12 months. |