Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
View larger 
Data sheet of Mouse Recombinant Scavenger Receptor Class D Member 1 (SCARD1)
| Brand | Cloud Clone |
| Product type | Proteins |
| Origin species | Mouse |
| Host species | Escherichia coli (E. coli) |
| Applications | SDS-PAGE, WB, ELISA, IP |
More info about Mouse Recombinant Scavenger Receptor Class D Member 1 (SCARD1)
| Catalog no.: | RPB257Mu01 |
| Product name : | Recombinant Scavenger Receptor Class D Member 1 (SCARD1) |
| Uniprot id: | P31996 |
| Purity: | ≥ 95% |
| Predicted molecular mass(kd): | 54.33kDa |
| Fragment: | Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA |
| Tag: | two N-terminal Tags, His-tag and GST-tag |
| Expression system: | Prokaryotic expression |
| Delivery condition: | 4℃ with ice bags |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 4℃ for frequent use. Aliquot and store at -20℃ for 12 months. |