Villin monoclonal antibody, clone VIL1/1325 View larger

Villin monoclonal antibody, clone VIL1/1325

New product

289,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of Villin monoclonal antibody, clone VIL1/1325

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
ClonalityMonoclonal
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,Flow Cyt

More info about Villin monoclonal antibody, clone VIL1/1325

Product description: Mouse monoclonal antibody raised against partial recombinant human Villin.
Clone: VIL1/1325
Isotype: IgG1, kappa
Immunogen: Recombinant protein corresponding to 133 residues of human Villin.
Immunogen sequence/protein sequence: MGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGA
Form: Liquid
Recommend dilutions: Flow Cytometry (0.5-1 ug/106 cells in 0.1 mL)
Immunofluorescence (1-2 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (0.25-0.5 ug/mL)
Western Blotting (1-2 ug/mL)
The optimal working dilution should be d
Storage buffer: In 10 mM PBS (0.05% BSA, 0.05% sodium azide).
Storage instruction: Store at 4°C.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Size: 100 ug
Shipping condition: Blue Ice

Reviews

Buy Villin monoclonal antibody, clone VIL1/1325 now

Add to cart