Product description: | Mouse monoclonal antibody raised against a partial recombinant FAS. |
Clone: | 3C4 |
Isotype: | IgG1 Kappa |
Gene id: | 355 |
Gene name: | FAS |
Gene alias: | ALPS1A|APO-1|APT1|CD95|FAS1|FASTM|TNFRSF6 |
Gene description: | Fas (TNF receptor superfamily, member 6) |
Genbank accession: | BC012479.1 |
Immunogen: | FAS (AAH12479.1, 211 a.a. ~ 320 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITS |
Protein accession: | AAH12479.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Size: | 100 ug |
Shipping condition: | Dry Ice |