Product description: | Mouse monoclonal antibody raised against a partial recombinant TNFRSF10C. |
Clone: | 4D12 |
Isotype: | IgG1 Kappa |
Gene id: | 8794 |
Gene name: | TNFRSF10C |
Gene alias: | CD263|DCR1|LIT|MGC149501|MGC149502|TRAILR3|TRID |
Gene description: | tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain |
Genbank accession: | NM_003841.2 |
Immunogen: | TNFRSF10C (NP_003832.2, 25 a.a. ~ 161 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVET |
Protein accession: | NP_003832.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Size: | 100 ug |
Shipping condition: | Dry Ice |