TNFRSF10A monoclonal antibody (M06), clone 8F4 View larger

TNFRSF10A monoclonal antibody (M06), clone 8F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF10A monoclonal antibody (M06), clone 8F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about TNFRSF10A monoclonal antibody (M06), clone 8F4

Brand: Abnova
Reference: MAB1180-M06
Product name: TNFRSF10A monoclonal antibody (M06), clone 8F4
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFRSF10A.
Clone: 8F4
Isotype: IgG2b Kappa
Gene id: 8797
Gene name: TNFRSF10A
Gene alias: APO2|CD261|DR4|MGC9365|TRAILR-1|TRAILR1
Gene description: tumor necrosis factor receptor superfamily, member 10a
Genbank accession: BC012866.1
Immunogen: TNFRSF10A (AAH12866.1, 103 a.a. ~ 239 a.a) partial recombinant protein.
Immunogen sequence/protein sequence: VVPSSAATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN
Protein accession: AAH12866.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy TNFRSF10A monoclonal antibody (M06), clone 8F4 now

Add to cart