Brand: | Abnova |
Reference: | MAB0042-M02 |
Product name: | GST tag monoclonal antibody, clone S2 |
Product description: | Mouse monoclonal antibody raised against GST recombinant protein. |
Isotype: | IgG1 |
Genbank accession: | U78874 |
Immunogen: | GST tag. MW of the GST tag is 26 KDa. |
Immunogen sequence/protein sequence: | MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV |
Protein accession: | AAB37352 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against GST on ELISA and Western Blot. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (25.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,WB-Re |
Shipping condition: | Dry Ice |