GST tag monoclonal antibody, clone S2 View larger

GST tag monoclonal antibody, clone S2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GST tag monoclonal antibody, clone S2

BrandAbnova
Product typePrimary antibodies
Host speciesMouse
ApplicationsS-ELISA,WB-Re

More info about GST tag monoclonal antibody, clone S2

Brand: Abnova
Reference: MAB0042-M02
Product name: GST tag monoclonal antibody, clone S2
Product description: Mouse monoclonal antibody raised against GST recombinant protein.
Isotype: IgG1
Genbank accession: U78874
Immunogen: GST tag. MW of the GST tag is 26 KDa.
Immunogen sequence/protein sequence: MESPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLEDPGYRGRTSFV
Protein accession: AAB37352
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against GST on ELISA and Western Blot.
Quality control testing picture: qc_test-MAB0042-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (25.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Application image: MAB0042-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy GST tag monoclonal antibody, clone S2 now

Add to cart