Brand: | Abnova |
Reference: | H00729991-M14 |
Product name: | MEF2BNB monoclonal antibody (M14), clone 4G1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MEF2BNB. |
Clone: | 4G1 |
Isotype: | IgG1 Kappa |
Gene id: | 729991 |
Gene name: | MEF2BNB |
Gene alias: | - |
Gene description: | MEF2B neighbor |
Genbank accession: | BC010931.1 |
Immunogen: | MEF2BNB (AAH10931.1, 1 a.a. ~ 119 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVYFRSVEGLLKQAISIRDHMNASAQGHSPEEPPPPSSA |
Protein accession: | AAH10931.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MEF2BNB on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |