Brand: | Abnova |
Reference: | H00729991-M08A |
Product name: | MEF2BNB monoclonal antibody (M08A), clone 1A3 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MEF2BNB. |
Clone: | 1A3 |
Isotype: | IgM Kappa |
Gene id: | 729991 |
Gene name: | MEF2BNB |
Gene alias: | - |
Gene description: | MEF2B neighbor |
Genbank accession: | BC004449.1 |
Immunogen: | MEF2BNB (AAH04449.1, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASAQGHR |
Protein accession: | AAH04449.1 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MEF2BNB monoclonal antibody (M08A), clone 1A3 Western Blot analysis of MEF2BNB expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,ELISA |
Shipping condition: | Dry Ice |