MEF2BNB monoclonal antibody (M07), clone 2H4 View larger

MEF2BNB monoclonal antibody (M07), clone 2H4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MEF2BNB monoclonal antibody (M07), clone 2H4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MEF2BNB monoclonal antibody (M07), clone 2H4

Brand: Abnova
Reference: H00729991-M07
Product name: MEF2BNB monoclonal antibody (M07), clone 2H4
Product description: Mouse monoclonal antibody raised against a full length recombinant MEF2BNB.
Clone: 2H4
Isotype: IgG2b Kappa
Gene id: 729991
Gene name: MEF2BNB
Gene alias: -
Gene description: MEF2B neighbor
Genbank accession: BC004449.1
Immunogen: MEF2BNB (AAH04449.1, 1 a.a. ~ 109 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASAQGHR
Protein accession: AAH04449.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00729991-M07-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MEF2BNB is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MEF2BNB monoclonal antibody (M07), clone 2H4 now

Add to cart