Brand: | Abnova |
Reference: | H00728642-M01 |
Product name: | CDC2L2 monoclonal antibody (M01), clone 1A9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDC2L2. |
Clone: | 1A9 |
Isotype: | IgG2a kappa |
Gene id: | 728642 |
Gene name: | CDC2L2 |
Gene alias: | CDC2L3|CDK11-p110|CDK11-p46|CDK11-p58|MGC131975|PITSLRE|p58GTA |
Gene description: | cell division cycle 2-like 2 (PITSLRE proteins) |
Genbank accession: | NM_033531 |
Immunogen: | CDC2L2 (NP_277073, 681 a.a. ~ 780 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GFDLMNKFLTYFPGRRISAEDGLKHEYFRETPLPIDPSMFPTWPAKSEQQRVKRGTSPRPPEGGLGYSQLGDDDLKETGFHLTTTNQGASAAGPGFSLKF |
Protein accession: | NP_277073 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CDC2L2 is approximately 0.03ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |