Brand: | Abnova |
Reference: | H00653509-M06 |
Product name: | SFTPA1 monoclonal antibody (M06), clone 4C4 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant SFTPA1. |
Clone: | 4C4 |
Isotype: | IgG1 Kappa |
Gene id: | 653509 |
Gene name: | SFTPA1 |
Gene alias: | COLEC4|FLJ51913|SFTP1|SP-A|SP-A1 |
Gene description: | surfactant protein A1 |
Genbank accession: | NM_001164646.1 |
Immunogen: | SFTPA1 (NP_001158118.1, 83 a.a. ~ 199 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
Protein accession: | NP_001158118.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to SFTPA1 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |