PEF1 MaxPab mouse polyclonal antibody (B01) View larger

PEF1 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PEF1 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about PEF1 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00553115-B01
Product name: PEF1 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human PEF1 protein.
Gene id: 553115
Gene name: PEF1
Gene alias: PEF1A|PEFLIN
Gene description: penta-EF-hand domain containing 1
Genbank accession: BC002773
Immunogen: PEF1 (AAH02773, 1 a.a. ~ 284 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASYPYRQGCPGAAGQAPGAPPGSYYPGPPNSGGQYGSGLPPGGGYGGPAPGGPYGPPAGGGPYGHPNPGMFPSGTPGGPYGGAAPGGPYGQPPPSSYGAQQPGLYGQGGAPPNVDPEAYSWFQSVDSDHSGYISMKELKQALVNCNWSSFNDETCLMMINMFDKTKSGRIDVYGFSALWKFIQQWKNLFQQYDRDRSGSISYTELQQALSQMGYNLSPQFTQLLVSRYCPRSANPAMQLDRFIQVCTQLQVLTEAFREKDTAVQGNIRLSFEDFVTMTASRML
Protein accession: AAH02773
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00553115-B01-2-B1-1.jpg
Application image note: PEF1 MaxPab polyclonal antibody. Western Blot analysis of PEF1 expression in human thyroid (diffuse hyperplasia).
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PEF1 MaxPab mouse polyclonal antibody (B01) now

Add to cart