Brand: | Abnova |
Reference: | H00541473-D01P |
Product name: | LOC541473 purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human LOC541473 protein. |
Gene id: | 541473 |
Gene name: | LOC541473 |
Gene alias: | MGC88170 |
Gene description: | FK506 binding protein 6, 36kDa pseudogene |
Genbank accession: | NM_001013748.1 |
Immunogen: | LOC541473 (NP_001013770.1, 1 a.a. ~ 131 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS |
Protein accession: | NP_001013770.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Western Blot analysis of LOC541473 expression in transfected 293T cell line () by LOC541473 MaxPab polyclonal antibody.
Lane 1: LOC541473 transfected lysate(14.50 KDa). Lane 2: Non-transfected lysate.
|
Applications: | WB-Ce,IF,WB-Tr |
Shipping condition: | Dry Ice |