| Brand: | Abnova |
| Reference: | H00541473-D01P |
| Product name: | LOC541473 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human LOC541473 protein. |
| Gene id: | 541473 |
| Gene name: | LOC541473 |
| Gene alias: | MGC88170 |
| Gene description: | FK506 binding protein 6, 36kDa pseudogene |
| Genbank accession: | NM_001013748.1 |
| Immunogen: | LOC541473 (NP_001013770.1, 1 a.a. ~ 131 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGGSALNQGVLEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYYGYLEHLDRPFDSNYFRKTPRLMKLGEDITLWGMELGLLSMQRGELARCFVLGKLLDSQGPSLHLYLRAS |
| Protein accession: | NP_001013770.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of LOC541473 expression in transfected 293T cell line () by LOC541473 MaxPab polyclonal antibody.
Lane 1: LOC541473 transfected lysate(14.50 KDa).
Lane 2: Non-transfected lysate.
|
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |
