GPX8 purified MaxPab mouse polyclonal antibody (B01P) View larger

GPX8 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPX8 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about GPX8 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00493869-B01P
Product name: GPX8 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GPX8 protein.
Gene id: 493869
Gene name: GPX8
Gene alias: UNQ847
Gene description: glutathione peroxidase 8 (putative)
Genbank accession: NM_001008397
Immunogen: GPX8 (NP_001008398.1, 1 a.a. ~ 209 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL
Protein accession: NP_001008398.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00493869-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GPX8 expression in transfected 293T cell line (H00493869-T02) by GPX8 MaxPab polyclonal antibody.

Lane 1: GPX8 transfected lysate(22.99 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GPX8 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart