Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TRIM72 monoclonal antibody (M04), clone 2B8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,IP |
More info about TRIM72 monoclonal antibody (M04), clone 2B8
| Brand: | Abnova |
| Reference: | H00493829-M04 |
| Product name: | TRIM72 monoclonal antibody (M04), clone 2B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant LOC493829. |
| Clone: | 2B8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 493829 |
| Gene name: | TRIM72 |
| Gene alias: | - |
| Gene description: | tripartite motif-containing 72 |
| Genbank accession: | NM_001008274 |
| Immunogen: | TRIM72 (NP_001008275.1, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | QGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFGDGVLSFYDASDADALVPLFAFHERLPRPVYPFFDVCWHDKGKNAQPLLLVGPEGAEA |
| Protein accession: | NP_001008275.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged TRIM72 is 0.3 ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,IP |
| Shipping condition: | Dry Ice |
| Publications: | Lack of MG53 in human heart precludes utility as a biomarker of myocardial injury or endogenous cardioprotective factor.Lemckert FA, Bournazos A, Eckert DM, Kenzler M, Hawkes JM, Butler TL, Ceely B, North KN, Winlaw DS, Egan JR, Cooper ST. Cardiovasc Res. 2016 Jan 19. [Epub ahead of print] |