Cart 58 Product Products 16 037,40 € (empty)
No products
To be determined Shipping
16 037,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 58 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 16 037,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 16 037,40 €
Data sheet of GIMAP6 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about GIMAP6 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00474344-B01P |
| Product name: | GIMAP6 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human GIMAP6 protein. |
| Gene id: | 474344 |
| Gene name: | GIMAP6 |
| Gene alias: | DKFZp686A01175|FLJ22690|IAN6|hIAN2 |
| Gene description: | GTPase, IMAP family member 6 |
| Genbank accession: | NM_024711.3 |
| Immunogen: | GIMAP6 (NP_078987.3, 1 a.a. ~ 292 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL |
| Protein accession: | NP_078987.3 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GIMAP6 expression in transfected 293T cell line (H00474344-T01) by GIMAP6 MaxPab polyclonal antibody. Lane 1: GIMAP6 transfected lysate(32.12 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |