Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00440456-B01 |
Product name: | LOC440456 MaxPab mouse polyclonal antibody (B01) |
Product description: | Mouse polyclonal antibody raised against a full-length human LOC440456 protein. |
Gene id: | 440456 |
Gene name: | PLEKHM1P |
Gene alias: | - |
Gene description: | pleckstrin homology domain containing, family M (with RUN domain) member 1 pseudogene |
Genbank accession: | XM_942463.1 |
Immunogen: | LOC440456 (ENSP00000313104, 1 a.a. ~ 237 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MTSPRTGTPALDNQPQTGIPRAAGGRDAGTPGQQIPGGEGKGEGGTGEAHPPWAPLATSQRPFRRSLPGSGPRLSAPVLVPMPPKVPSRGIQVPPRPAQTQLLWVWVTALLSVAVPIRCRCQLRFRETSPAPPRKPRPGRWSGPNLPAPPTRPLGSLRPAQQTRGTLDKVAKEPYGSPGLDPAPSVPQPRQAAVSWPLAWVTLGGRRRCGQCGSLEGPCTSGEDHRLMALVEGRRQI |
Protein accession: | ENSP00000313104 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PLEKHM1P expression in transfected 293T cell line (H00440456-T01) by PLEKHM1P MaxPab polyclonal antibody. Lane 1: LOC440456 transfected lysate(26.07 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |