Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LOC440456 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about LOC440456 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00440456-B01 |
| Product name: | LOC440456 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human LOC440456 protein. |
| Gene id: | 440456 |
| Gene name: | PLEKHM1P |
| Gene alias: | - |
| Gene description: | pleckstrin homology domain containing, family M (with RUN domain) member 1 pseudogene |
| Genbank accession: | XM_942463.1 |
| Immunogen: | LOC440456 (ENSP00000313104, 1 a.a. ~ 237 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MTSPRTGTPALDNQPQTGIPRAAGGRDAGTPGQQIPGGEGKGEGGTGEAHPPWAPLATSQRPFRRSLPGSGPRLSAPVLVPMPPKVPSRGIQVPPRPAQTQLLWVWVTALLSVAVPIRCRCQLRFRETSPAPPRKPRPGRWSGPNLPAPPTRPLGSLRPAQQTRGTLDKVAKEPYGSPGLDPAPSVPQPRQAAVSWPLAWVTLGGRRRCGQCGSLEGPCTSGEDHRLMALVEGRRQI |
| Protein accession: | ENSP00000313104 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PLEKHM1P expression in transfected 293T cell line (H00440456-T01) by PLEKHM1P MaxPab polyclonal antibody. Lane 1: LOC440456 transfected lysate(26.07 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |