Brand: | Abnova |
Reference: | H00414899-M05 |
Product name: | BRCC2 monoclonal antibody (M05), clone 3F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BRCC2. |
Clone: | 3F4 |
Isotype: | IgG2a Kappa |
Gene id: | 414899 |
Gene name: | BLID |
Gene alias: | BRCC2|BRCC@|MGC163233|MGC163235 |
Gene description: | BH3-like motif containing, cell death inducer |
Genbank accession: | NM_001001786 |
Immunogen: | BRCC2 (NP_001001786, 2 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VTLLPIEGQEVHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL |
Protein accession: | NP_001001786 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to BLID on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |