DNAJB3 purified MaxPab mouse polyclonal antibody (B01P) View larger

DNAJB3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAJB3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DNAJB3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00414061-B01P
Product name: DNAJB3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human DNAJB3 protein.
Gene id: 414061
Gene name: DNAJB3
Gene alias: HCG3|MGC26879
Gene description: DnaJ (Hsp40) homolog, subfamily B, member 3
Genbank accession: NM_001001394
Immunogen: DNAJB3 (NP_001001394.1, 1 a.a. ~ 145 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGEAGAEGGCTGGRPFEDPFEYVFSFRDPADVFREFFGGQDPFSFDLLGNPLENILGGSEELLGKQKQSVCTPFLCLQ
Protein accession: NP_001001394.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00414061-B01P-13-15-1.jpg
Application image note: Western Blot analysis of DNAJB3 expression in transfected 293T cell line (H00414061-T01) by DNAJB3 MaxPab polyclonal antibody.

Lane 1: HCG3 transfected lysate(15.95 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DNAJB3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart