Brand: | Abnova |
Reference: | H00404037-M01 |
Product name: | HAPLN4 monoclonal antibody (M01), clone 3H1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant HAPLN4. |
Clone: | 3H1 |
Isotype: | IgG2b Kappa |
Gene id: | 404037 |
Gene name: | HAPLN4 |
Gene alias: | BRAL2|KIAA1926 |
Gene description: | hyaluronan and proteoglycan link protein 4 |
Genbank accession: | NM_023002 |
Immunogen: | HAPLN4 (NP_075378, 30 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT |
Protein accession: | NP_075378 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged HAPLN4 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |