FLJ39779 MaxPab mouse polyclonal antibody (B01) View larger

FLJ39779 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ39779 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FLJ39779 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00400223-B01
Product name: FLJ39779 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FLJ39779 protein.
Gene id: 400223
Gene name: C14orf181
Gene alias: FLJ39779
Gene description: chromosome 14 open reading frame 181
Genbank accession: BC148845
Immunogen: FLJ39779 (AAI48846.1, 1 a.a. ~ 166 a.a) full-length human protein.
Immunogen sequence/protein sequence: MNTYTRSASFTPKTFTFPLAQNRTSHPTTTSKLKYLGRPSPRRDALQANGEGPEVGPGTEEPAHRLPVGSGSAGEAAASLGTARVRSGRAECTAKLAGDGHARLASAFLHRRAALPPPLGTCRPRLGEGGSAPALGPSPRRGRRVSEGLRDSLPPLGSLTLGKSPK
Protein accession: AAI48846.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00400223-B01-13-15-1.jpg
Application image note: Western Blot analysis of C14orf181 expression in transfected 293T cell line (H00400223-T01) by C14orf181 MaxPab polyclonal antibody.

Lane 1: FLJ39779 transfected lysate(18.26 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FLJ39779 MaxPab mouse polyclonal antibody (B01) now

Add to cart