LOC391746 MaxPab mouse polyclonal antibody (B01) View larger

LOC391746 MaxPab mouse polyclonal antibody (B01)

H00391746-B01_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOC391746 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LOC391746 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00391746-B01
Product name: LOC391746 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human LOC391746 protein.
Gene id: 391746
Gene name: LOC391746
Gene alias: -
Gene description: similar to hCG1809904
Genbank accession: XM_373058.2
Immunogen: LOC391746 (XP_373058.2, 1 a.a. ~ 198 a.a) full-length human protein.
Immunogen sequence/protein sequence: METGRQTGVSAEMLAMPRGLKGSKKDGIPEDLDGNLEAPRDQEGELRSEDVMDLTEGDSEASASAPPAAKRRKTHTKGKKESKPTVDAEEAQRMTTLLSSMSEEQLSRYEVCRRSAFPRARVAGLMRAITGSSVSENAAIAMAGIAKLFVGEVVEEALDVCEMWGETPPLQPKHLREAVRRLKPKGLFPNSNCKRIMF
Protein accession: XP_373058.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00391746-B01-13-15-1.jpg
Application image note: Western Blot analysis of LOC391746 expression in transfected 293T cell line (H00391746-T01) by LOC391746 MaxPab polyclonal antibody.

Lane 1: LOC391746 transfected lysate(21.78 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LOC391746 MaxPab mouse polyclonal antibody (B01) now

Add to cart