LOC390748 purified MaxPab mouse polyclonal antibody (B01P) View larger

LOC390748 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LOC390748 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about LOC390748 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00390748-B01P
Product name: LOC390748 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human LOC390748 protein.
Gene id: 390748
Gene name: LOC390748
Gene alias: ePABP2
Gene description: similar to poly(A)binding protein nuclear-like 1
Genbank accession: BC156595.1
Immunogen: LOC390748 (AAI56596.1, 1 a.a. ~ 289 a.a) full-length human protein.
Immunogen sequence/protein sequence: MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEEDQDGDAGFLLSLLEQENLAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQQAEEEEGTAAGQLLSPETVGCPLSGTPEEKVEADHRSVYVGNVDYGGSAEELEAHFSRCGEVHRVTILCDKFSGHPKGYAYIEFATKGSVQAAVELDQSLFRGRVIKVLPKRTNFPGISSTDRGGLRGHPGSRGAPFPHSGLQGRPRLRPQGQNRTPAALTPLWARPLPWVVVSHVIK
Protein accession: AAI56596.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00390748-B01P-13-15-1.jpg
Application image note: Western Blot analysis of LOC390748 expression in transfected 293T cell line (H00390748-T01) by LOC390748 MaxPab polyclonal antibody.

Lane 1: LOC390748 transfected lysate(31.79 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy LOC390748 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart