C1QL3 purified MaxPab mouse polyclonal antibody (B01P) View larger

C1QL3 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1QL3 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about C1QL3 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00389941-B01P
Product name: C1QL3 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human C1QL3 protein.
Gene id: 389941
Gene name: C1QL3
Gene alias: C1ql|K100
Gene description: complement component 1, q subcomponent-like 3
Genbank accession: BC160038.1
Immunogen: C1QL3 (AAI60038.1, 1 a.a. ~ 255 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPMGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Protein accession: AAI60038.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00389941-B01P-13-15-1.jpg
Application image note: Western Blot analysis of C1QL3 expression in transfected 293T cell line (H00389941-T01) by C1QL3 MaxPab polyclonal antibody.

Lane 1: C1QL3 transfected lysate(28.05 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C1QL3 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart