Cart 8 Product Products 2 046,44 € (empty)
Product successfully added to your shopping cart
Quantity
Total
There are 8 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 046,44 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 046,44 €
Data sheet of ZCCHC13 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about ZCCHC13 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00389874-B01P |
| Product name: | ZCCHC13 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ZCCHC13 protein. |
| Gene id: | 389874 |
| Gene name: | ZCCHC13 |
| Gene alias: | Cnbp2|ZNF9L |
| Gene description: | zinc finger, CCHC domain containing 13 |
| Genbank accession: | NM_203303.1 |
| Immunogen: | ZCCHC13 (NP_976048.1, 1 a.a. ~ 166 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSSKDFFACGHSGHWARGCPRGGAGGRRGGGHGRGSQCGSTTLSYTCYCCGESGRNAKNCVLLGNICYNCGRSGHIAKDCKDPKRERRQHCYTCGRLGHLARDCDRQKEQKCYSCGKLGHIQKDCAQVKCYRCGEIGHVAINCSKARPGQLLPLRQIPTSSQGMSQ |
| Protein accession: | NP_976048.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZCCHC13 expression in transfected 293T cell line (H00389874-T01) by ZCCHC13 MaxPab polyclonal antibody. Lane 1: ZCCHC13 transfected lysate(18.26 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |