MAP3K15 monoclonal antibody (M02), clone 1H7 View larger

MAP3K15 monoclonal antibody (M02), clone 1H7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP3K15 monoclonal antibody (M02), clone 1H7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MAP3K15 monoclonal antibody (M02), clone 1H7

Brand: Abnova
Reference: H00389840-M02
Product name: MAP3K15 monoclonal antibody (M02), clone 1H7
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP3K15.
Clone: 1H7
Isotype: IgG2b Kappa
Gene id: 389840
Gene name: MAP3K15
Gene alias: FLJ16518|bA723P2.3
Gene description: mitogen-activated protein kinase kinase kinase 15
Genbank accession: NM_001001671
Immunogen: MAP3K15 (NP_001001671, 691 a.a. ~ 786 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKTIEKIVEEGYTLSDILNEITKEDLRYLRLRGGLLCRLWSAVSQYRRAQEASETKD
Protein accession: NP_001001671
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00389840-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00389840-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged MAP3K15 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAP3K15 monoclonal antibody (M02), clone 1H7 now

Add to cart