MAFA monoclonal antibody (M01), clone 2F1 View larger

MAFA monoclonal antibody (M01), clone 2F1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAFA monoclonal antibody (M01), clone 2F1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MAFA monoclonal antibody (M01), clone 2F1

Brand: Abnova
Reference: H00389692-M01
Product name: MAFA monoclonal antibody (M01), clone 2F1
Product description: Mouse monoclonal antibody raised against a partial recombinant MAFA.
Clone: 2F1
Isotype: IgG2a Kappa
Gene id: 389692
Gene name: MAFA
Gene alias: RIPE3b1|hMafA
Gene description: v-maf musculoaponeurotic fibrosarcoma oncogene homolog A (avian)
Genbank accession: NM_201589
Immunogen: MAFA (NP_963883, 222 a.a. ~ 308 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LEERFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDL
Protein accession: NP_963883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00389692-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.31 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00389692-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MAFA is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAFA monoclonal antibody (M01), clone 2F1 now

Add to cart